HNRPL antibody

Name HNRPL antibody
Supplier Fitzgerald
Catalog 70R-1334
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications IHC WB
Species Reactivities Human, Dog
Antigen HNRPL antibody was raised using the N terminal of HNRPL corresponding to a region with amino acids RRRSGAMVKMAAAGGGGGGGRYYGGGSEGGRAPKRLKTDNAGDQHGGGGG
Purity/Format Total IgG Protein A purified
Blocking Peptide HNRPL Blocking Peptide
Description Rabbit polyclonal HNRPL antibody raised against the N terminal of HNRPL
Gene HNRNPL
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.