DYNLL1 antibody

Name DYNLL1 antibody
Supplier Fitzgerald
Catalog 70R-2617
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen DYNLL1 antibody was raised using the middle region of DYNLL1 corresponding to a region with amino acids EKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAIL
Purity/Format Affinity purified
Blocking Peptide DYNLL1 Blocking Peptide
Description Rabbit polyclonal DYNLL1 antibody raised against the middle region of DYNLL1
Gene DLEC1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.