Name | RNF170 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6665 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | RNF170 antibody was raised using the middle region of RNF170 corresponding to a region with amino acids CIIAYWRYGSWLGAISCPICRQTVTLLLTVFGEDDQSQDVLRLHQDINDY |
Purity/Format | Affinity purified |
Blocking Peptide | RNF170 Blocking Peptide |
Description | Rabbit polyclonal RNF170 antibody raised against the middle region of RNF170 |
Gene | RNF170 |
Supplier Page | Shop |