DHDH antibody

Name DHDH antibody
Supplier Fitzgerald
Catalog 70R-4443
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen DHDH antibody was raised using a synthetic peptide corresponding to a region with amino acids PCWCPTELVVKGEHKEFPLPPVPKDCNFDNGAGMSYEAKHVWECLRKGMK
Purity/Format Affinity purified
Blocking Peptide DHDH Blocking Peptide
Description Rabbit polyclonal DHDH antibody
Gene DHDH
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.