| Name | ENOSF1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3354 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ENOSF1 antibody was raised using the N terminal of ENOSF1 corresponding to a region with amino acids MVRGRISRLSVRDVRFPTSLGGHGADAMHTDPDYSAAYVVIETDAEDGIK |
| Purity/Format | Affinity purified |
| Blocking Peptide | ENOSF1 Blocking Peptide |
| Description | Rabbit polyclonal ENOSF1 antibody raised against the N terminal of ENOSF1 |
| Gene | ENOSF1 |
| Supplier Page | Shop |