| Name | Transglutaminase 5 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2264 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Transglutaminase 5 antibody was raised using the C terminal of TGM5 corresponding to a region with amino acids VLKPQHQASIILETVPFKSGQRQIQANMRSNKFKDIKGYRNVYVDFAL |
| Purity/Format | Affinity purified |
| Blocking Peptide | Transglutaminase 5 Blocking Peptide |
| Description | Rabbit polyclonal Transglutaminase 5 antibody raised against the C terminal of TGM5 |
| Gene | TGM5 |
| Supplier Page | Shop |