| Name | C17ORF48 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4091 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C17ORF48 antibody was raised using the middle region of C17Orf48 corresponding to a region with amino acids KYEQCMKILREHNPNTELNSPQGLSEPQFVQFNGGFSQEQLNWLNEVLTF |
| Purity/Format | Affinity purified |
| Blocking Peptide | C17ORF48 Blocking Peptide |
| Description | Rabbit polyclonal C17ORF48 antibody raised against the middle region of C17Orf48 |
| Gene | ADPRM |
| Supplier Page | Shop |