| Name | DPYS antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1173 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | DPYS antibody was raised using the N terminal of DPYS corresponding to a region with amino acids VLDAAGKLVLPGGIDTHTHMQFPFMGSRSIDDFHQGTKAALSGGTTMIID |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | DPYS Blocking Peptide |
| Description | Rabbit polyclonal DPYS antibody raised against the N terminal of DPYS |
| Gene | DPYS |
| Supplier Page | Shop |