| Name | SYT9 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7051 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | SYT9 antibody was raised using the middle region of SYT9 corresponding to a region with amino acids PDFNIQQLQKQEQLTGIGRIKPELYKQRSLDNDDGRRSNSKACGKLNFIL |
| Purity/Format | Affinity purified |
| Blocking Peptide | SYT9 Blocking Peptide |
| Description | Rabbit polyclonal SYT9 antibody raised against the middle region of SYT9 |
| Gene | SYT9 |
| Supplier Page | Shop |