| Name | MGC70924 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3194 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | MGC70924 antibody was raised using the N terminal Of Mgc70924 corresponding to a region with amino acids MDTQGPVSQPFQQPEKPGRVRRRKTRRERNKALVGSRRPLAHHDPPVAIR |
| Purity/Format | Affinity purified |
| Blocking Peptide | MGC70924 Blocking Peptide |
| Description | Rabbit polyclonal MGC70924 antibody raised against the N terminal Of Mgc70924 |
| Gene | PRR19 |
| Supplier Page | Shop |