CNTNAP1 antibody

• Supplier: Fitzgerald
• Catalog: 70R-6158
• Prices: $345.00
• Sizes: 50 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: CNTNAP1 antibody was raised using the N terminal of CNTNAP1 corresponding to a region with amino acids LQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHNS
• Purity/Format: Affinity purified
• Blocking Peptide: CNTNAP1 Blocking Peptide
• Description: Rabbit polyclonal CNTNAP1 antibody raised against the N terminal of CNTNAP1
• Gene: CNTNAP1