| Name | WNT5B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1563 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | WNT5B antibody was raised using the C terminal of WNT5B corresponding to a region with amino acids GRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCKFHWCCFVRCKKCT |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | WNT5B Blocking Peptide |
| Description | Rabbit polyclonal WNT5B antibody raised against the C terminal of WNT5B |
| Gene | WNT5B |
| Supplier Page | Shop |