CACNG6 antibody

• Supplier: Fitzgerald
• Catalog: 70R-1499
• Prices: $275.00
• Sizes: 100 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: CACNG6 antibody was raised using the N terminal of CACNG6 corresponding to a region with amino acids RAHGQGRSGLTPEREGKVKLALLLAAVGATLAVLSVGTEFWVELNTYKAN
• Purity/Format: Total IgG Protein A purified
• Blocking Peptide: CACNG6 Blocking Peptide
• Description: Rabbit polyclonal CACNG6 antibody raised against the N terminal of CACNG6
• Gene: CACNG6