Name | TRIM59 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6350 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Dog |
Antigen | TRIM59 antibody was raised using the N terminal of TRIM59 corresponding to a region with amino acids RIPLKCPNCRSITEIAPTGIESLPVNFALRAIIEKYQQEDHPDIVTCPEH |
Purity/Format | Affinity purified |
Blocking Peptide | TRIM59 Blocking Peptide |
Description | Rabbit polyclonal TRIM59 antibody raised against the N terminal of TRIM59 |
Gene | TRIM59 |
Supplier Page | Shop |