| Name | TRIM59 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6350 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Dog |
| Antigen | TRIM59 antibody was raised using the N terminal of TRIM59 corresponding to a region with amino acids RIPLKCPNCRSITEIAPTGIESLPVNFALRAIIEKYQQEDHPDIVTCPEH |
| Purity/Format | Affinity purified |
| Blocking Peptide | TRIM59 Blocking Peptide |
| Description | Rabbit polyclonal TRIM59 antibody raised against the N terminal of TRIM59 |
| Gene | TRIM59 |
| Supplier Page | Shop |