| Name | NMBR antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5956 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | NMBR antibody was raised using the N terminal of NMBR corresponding to a region with amino acids PSKSLSNLSVTTGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYL |
| Purity/Format | Affinity purified |
| Blocking Peptide | NMBR Blocking Peptide |
| Description | Rabbit polyclonal NMBR antibody raised against the N terminal of NMBR |
| Gene | NMBR |
| Supplier Page | Shop |