| Name | TRIM43 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2814 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | TRIM43 antibody was raised using the C terminal of TRIM43 corresponding to a region with amino acids NSTMVNSEDIFLLLCLKVDNHFNLLTTSPVFPHYIEKPLGRVGVFLDFES |
| Purity/Format | Affinity purified |
| Blocking Peptide | TRIM43 Blocking Peptide |
| Description | Rabbit polyclonal TRIM43 antibody raised against the C terminal of TRIM43 |
| Gene | TRIM43 |
| Supplier Page | Shop |