Name | TMTC4 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6734 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | TMTC4 antibody was raised using the C terminal of TMTC4 corresponding to a region with amino acids NDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYHGNLAVLYHRW |
Purity/Format | Affinity purified |
Blocking Peptide | TMTC4 Blocking Peptide |
Description | Rabbit polyclonal TMTC4 antibody raised against the C terminal of TMTC4 |
Gene | TMTC4 |
Supplier Page | Shop |