| Name | GALE antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2878 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | GALE antibody was raised using the N terminal of GALE corresponding to a region with amino acids AEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRR |
| Purity/Format | Affinity purified |
| Blocking Peptide | GALE Blocking Peptide |
| Description | Rabbit polyclonal GALE antibody raised against the N terminal of GALE |
| Gene | GALE |
| Supplier Page | Shop |