| Name | Cytokeratin 222 Pseudogene antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4160 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | Cytokeratin 222 Pseudogene antibody was raised using the N terminal of KRT222P corresponding to a region with amino acids ELSQLLNEIRANYEKILTRNQIETVLSTRIQLEEDISKKMDKDEEALKAA |
| Purity/Format | Affinity purified |
| Blocking Peptide | Cytokeratin 222 Pseudogene Blocking Peptide |
| Description | Rabbit polyclonal Cytokeratin 222 Pseudogene antibody raised against the N terminal of KRT222P |
| Gene | KRT222 |
| Supplier Page | Shop |