| Name | Cytokeratin 13 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1178 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | Cytokeratin 13 antibody was raised using the C terminal of KRT13 corresponding to a region with amino acids EAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKKRQPP |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | Cytokeratin 13 Blocking Peptide |
| Description | Rabbit polyclonal Cytokeratin 13 antibody raised against the C terminal of KRT13 |
| Gene | KRT13 |
| Supplier Page | Shop |