Name | CCDC138 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3552 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | CCDC138 antibody was raised using the N terminal of CCDC138 corresponding to a region with amino acids EPRVVKPPGQDLVVESLKSRYGLGGSCPDEYDFSNFYQSKYKRRTLTSPG |
Purity/Format | Affinity purified |
Blocking Peptide | CCDC138 Blocking Peptide |
Description | Rabbit polyclonal CCDC138 antibody raised against the N terminal of CCDC138 |
Gene | CCDC138 |
Supplier Page | Shop |