| Name | SMPD1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7120 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | SMPD1 antibody was raised using the middle region of SMPD1 corresponding to a region with amino acids INSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV |
| Purity/Format | Affinity purified |
| Blocking Peptide | SMPD1 Blocking Peptide |
| Description | Rabbit polyclonal SMPD1 antibody raised against the middle region of SMPD1 |
| Gene | SMPD1 |
| Supplier Page | Shop |