| Name | DAZ2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4896 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | DAZ2 antibody was raised using the N terminal of DAZ2 corresponding to a region with amino acids MDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | DAZ2 Blocking Peptide |
| Description | Rabbit polyclonal DAZ2 antibody raised against the N terminal of DAZ2 |
| Gene | DAZ2 |
| Supplier Page | Shop |