| Name | MMP23B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6959 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | MMP23B antibody was raised using the middle region of MMP23B corresponding to a region with amino acids QKILHKKGKVYWYKDQEPLEFSYPGYLALGEAHLSIIANAVNEGTYTCVV |
| Purity/Format | Affinity purified |
| Blocking Peptide | MMP23B Blocking Peptide |
| Description | Rabbit polyclonal MMP23B antibody raised against the middle region of MMP23B |
| Gene | MMP23B |
| Supplier Page | Shop |