| Name | TOR2A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1821 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | TOR2A antibody was raised using the N terminal of TOR2A corresponding to a region with amino acids GLECDLAQHLAGQHLAKALVVKALKAFVRDPAPTKPLVLSLHGWTGTGKS |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | TOR2A Blocking Peptide |
| Description | Rabbit polyclonal TOR2A antibody raised against the N terminal of TOR2A |
| Gene | TOR2A |
| Supplier Page | Shop |