Name | TOR2A antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1821 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse |
Antigen | TOR2A antibody was raised using the N terminal of TOR2A corresponding to a region with amino acids GLECDLAQHLAGQHLAKALVVKALKAFVRDPAPTKPLVLSLHGWTGTGKS |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | TOR2A Blocking Peptide |
Description | Rabbit polyclonal TOR2A antibody raised against the N terminal of TOR2A |
Gene | TOR2A |
Supplier Page | Shop |