| Name | C5ORF35 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4192 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C5ORF35 antibody was raised using the N terminal Of C5Orf35 corresponding to a region with amino acids QSEILTMLPESVKSKYQDLLAVEHQGVKLRENRHQQQSTFKPEEILYKTL |
| Purity/Format | Affinity purified |
| Blocking Peptide | C5ORF35 Blocking Peptide |
| Description | Rabbit polyclonal C5ORF35 antibody raised against the N terminal Of C5Orf35 |
| Gene | SETD9 |
| Supplier Page | Shop |