NR4A3 antibody

Name NR4A3 antibody
Supplier Fitzgerald
Catalog 70R-3103
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen NR4A3 antibody was raised using the middle region of NR4A3 corresponding to a region with amino acids KCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMN
Purity/Format Affinity purified
Blocking Peptide NR4A3 Blocking Peptide
Description Rabbit polyclonal NR4A3 antibody raised against the middle region of NR4A3
Gene NR4A3
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.