| Name | PPP1CA antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2013 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | PPP1CA antibody was raised using the N terminal of PPP1CA corresponding to a region with amino acids MSDSEKLNLDSIIGRLLEGSRVLTPHCAPVQGSRPGKNVQLTENEIRGLC |
| Purity/Format | Affinity purified |
| Blocking Peptide | PPP1CA Blocking Peptide |
| Description | Rabbit polyclonal PPP1CA antibody raised against the N terminal of PPP1CA |
| Gene | PPP1CA |
| Supplier Page | Shop |