RPS15 antibody

Name RPS15 antibody
Supplier Fitzgerald
Catalog 70R-3006
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, C. elegans
Antigen RPS15 antibody was raised using the middle region of RPS15 corresponding to a region with amino acids GVYNGKTFNQVEIKPEMIGHYLGEFSITYKPVKHGRPGIGATHSSRFIPL
Purity/Format Affinity purified
Blocking Peptide RPS15 Blocking Peptide
Description Rabbit polyclonal RPS15 antibody raised against the middle region of RPS15
Gene RPS15
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.