Name | RPS15 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3006 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, C. elegans |
Antigen | RPS15 antibody was raised using the middle region of RPS15 corresponding to a region with amino acids GVYNGKTFNQVEIKPEMIGHYLGEFSITYKPVKHGRPGIGATHSSRFIPL |
Purity/Format | Affinity purified |
Blocking Peptide | RPS15 Blocking Peptide |
Description | Rabbit polyclonal RPS15 antibody raised against the middle region of RPS15 |
Gene | RPS15 |
Supplier Page | Shop |