| Name | C21ORF45 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3295 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C21ORF45 antibody was raised using the N terminal Of C21Orf45 corresponding to a region with amino acids MAGVRSLRCSRGCAGGCECGDKGKCSDSSLLGKRLSEDSSRHQLLQKWAS |
| Purity/Format | Affinity purified |
| Blocking Peptide | C21ORF45 Blocking Peptide |
| Description | Rabbit polyclonal C21ORF45 antibody raised against the N terminal Of C21Orf45 |
| Gene | MIS18A |
| Supplier Page | Shop |