| Name | PPAP2A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1660 |
| Prices | $315.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Zebrafish |
| Antigen | PPAP2A antibody was raised using the middle region of PPAP2A corresponding to a region with amino acids DPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVAL |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | PPAP2A Blocking Peptide |
| Description | Rabbit polyclonal PPAP2A antibody raised against the middle region of PPAP2A |
| Gene | PPAP2A |
| Supplier Page | Shop |