| Name | AK1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2397 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | AK1 antibody was raised using the middle region of AK1 corresponding to a region with amino acids RIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKAT |
| Purity/Format | Affinity purified |
| Blocking Peptide | AK1 Blocking Peptide |
| Description | Rabbit polyclonal AK1 antibody raised against the middle region of AK1 |
| Gene | AK1 |
| Supplier Page | Shop |