Name | STRBP antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4768 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | STRBP antibody was raised using the middle region of STRBP corresponding to a region with amino acids PSKKTAKLHVAVKVLQAMGYPTGFDADIECMSSDEKSDNESKNETVSSNS |
Purity/Format | Affinity purified |
Blocking Peptide | STRBP Blocking Peptide |
Description | Rabbit polyclonal STRBP antibody raised against the middle region of STRBP |
Gene | STRBP |
Supplier Page | Shop |