| Name | STRBP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4768 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | STRBP antibody was raised using the middle region of STRBP corresponding to a region with amino acids PSKKTAKLHVAVKVLQAMGYPTGFDADIECMSSDEKSDNESKNETVSSNS |
| Purity/Format | Affinity purified |
| Blocking Peptide | STRBP Blocking Peptide |
| Description | Rabbit polyclonal STRBP antibody raised against the middle region of STRBP |
| Gene | STRBP |
| Supplier Page | Shop |