| Name | Myotrophin antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2590 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | Myotrophin antibody was raised using the middle region of MTPN corresponding to a region with amino acids GRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCV |
| Purity/Format | Affinity purified |
| Blocking Peptide | Myotrophin Blocking Peptide |
| Description | Rabbit polyclonal Myotrophin antibody raised against the middle region of MTPN |
| Gene | MTPN |
| Supplier Page | Shop |