Name | MPG antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6638 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | MPG antibody was raised using the C terminal of MPG corresponding to a region with amino acids LEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQA |
Purity/Format | Affinity purified |
Blocking Peptide | MPG Blocking Peptide |
Description | Rabbit polyclonal MPG antibody raised against the C terminal of MPG |
Gene | MID1 |
Supplier Page | Shop |