| Name | MPG antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6638 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | MPG antibody was raised using the C terminal of MPG corresponding to a region with amino acids LEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQA |
| Purity/Format | Affinity purified |
| Blocking Peptide | MPG Blocking Peptide |
| Description | Rabbit polyclonal MPG antibody raised against the C terminal of MPG |
| Gene | MID1 |
| Supplier Page | Shop |