| Name | PRKX antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2237 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | PRKX antibody was raised using the N terminal of PRKX corresponding to a region with amino acids MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFD |
| Purity/Format | Affinity purified |
| Blocking Peptide | PRKX Blocking Peptide |
| Description | Rabbit polyclonal PRKX antibody raised against the N terminal of PRKX |
| Gene | PRKX |
| Supplier Page | Shop |