| Name | TBC1D24 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4064 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | TBC1D24 antibody was raised using the middle region of TBC1D24 corresponding to a region with amino acids SDPADRLSPFLAARHFNLPSKTESMFMAGGSDCLIVGGGGGQALYIDGDL |
| Purity/Format | Affinity purified |
| Blocking Peptide | TBC1D24 Blocking Peptide |
| Description | Rabbit polyclonal TBC1D24 antibody raised against the middle region of TBC1D24 |
| Gene | TBC1D24 |
| Supplier Page | Shop |