| Name | MAT1A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1146 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Dog |
| Antigen | MAT1A antibody was raised using the C terminal of MAT1A corresponding to a region with amino acids VAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFTYGTSQKTERELLDVVH |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | MAT1A Blocking Peptide |
| Description | Rabbit polyclonal MAT1A antibody raised against the C terminal of MAT1A |
| Gene | MAT1A |
| Supplier Page | Shop |