| Name | METTL7B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2974 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | METTL7B antibody was raised using the middle region of METTL7B corresponding to a region with amino acids FVVAPGEDMRQLADGSMDVVVCTLVLCSVQSPRKVLQEVRRVLRPGGVLF |
| Purity/Format | Affinity purified |
| Blocking Peptide | METTL7B Blocking Peptide |
| Description | Rabbit polyclonal METTL7B antibody raised against the middle region of METTL7B |
| Gene | METTL7B |
| Supplier Page | Shop |