Name | Selenoprotein antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5346 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | Selenoprotein antibody was raised using the middle region of 15 kDa Selenoprotein corresponding to a region with amino acids SDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLS |
Purity/Format | Affinity purified |
Blocking Peptide | Selenoprotein Blocking Peptide |
Description | Rabbit polyclonal Selenoprotein antibody raised against the middle region of 15 kDa Selenoprotein |
Gene | SEP15 |
Supplier Page | Shop |