| Name | Selenoprotein antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5346 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | Selenoprotein antibody was raised using the middle region of 15 kDa Selenoprotein corresponding to a region with amino acids SDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLS |
| Purity/Format | Affinity purified |
| Blocking Peptide | Selenoprotein Blocking Peptide |
| Description | Rabbit polyclonal Selenoprotein antibody raised against the middle region of 15 kDa Selenoprotein |
| Gene | SEP15 |
| Supplier Page | Shop |