| Name | MAOB antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6478 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Dog |
| Antigen | MAOB antibody was raised using the C terminal of MAOB corresponding to a region with amino acids GKIPEDEIWQSEPESVDVPAQPITTTFLERHLPSVPGLLRLIGLTTIFSA |
| Purity/Format | Affinity purified |
| Blocking Peptide | MAOB Blocking Peptide |
| Description | Rabbit polyclonal MAOB antibody raised against the C terminal of MAOB |
| Gene | MAOB |
| Supplier Page | Shop |