ADAM19 antibody

Name ADAM19 antibody
Supplier Fitzgerald
Catalog 70R-7216
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen ADAM19 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRELILDLEKNEQLFAPSYTETHYTSSGNPQTTTRKLEDHCFYHGTVRET
Purity/Format Affinity purified
Blocking Peptide ADAM19 Blocking Peptide
Description Rabbit polyclonal ADAM19 antibody
Gene ADAM19
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.