| Name | LDLRAD1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6670 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | LDLRAD1 antibody was raised using the middle region of LDLRAD1 corresponding to a region with amino acids DEDESLCRDVPQSLPHFLVAHCGDPASWIYSDQKCDGTNNCGDCSDELSP |
| Purity/Format | Affinity purified |
| Blocking Peptide | LDLRAD1 Blocking Peptide |
| Description | Rabbit polyclonal LDLRAD1 antibody raised against the middle region of LDLRAD1 |
| Gene | LDLRAD1 |
| Supplier Page | Shop |