| Name | A4GNT antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7409 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | A4GNT antibody was raised using the C terminal of A4GNT corresponding to a region with amino acids NISFLHPQRFYPISYREWRRYYEVWDTEPSFNVSYALHLWNHMNQEGRAV |
| Purity/Format | Affinity purified |
| Blocking Peptide | A4GNT Blocking Peptide |
| Description | Rabbit polyclonal A4GNT antibody raised against the C terminal of A4GNT |
| Gene | A4GNT |
| Supplier Page | Shop |