| Name | SEC63 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6862 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | SEC63 antibody was raised using a synthetic peptide corresponding to a region with amino acids WPRDQNAEQIRLKNIRKVYGRCMWYRLRLLKPQPNIIPTVKKIVLLAGWA |
| Purity/Format | Affinity purified |
| Blocking Peptide | SEC63 Blocking Peptide |
| Description | Rabbit polyclonal SEC63 antibody |
| Gene | SEC63 |
| Supplier Page | Shop |