| Name | TLR6 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2269 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | TLR6 antibody was raised using the middle region of TLR6 corresponding to a region with amino acids KCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYSKTTLKALTIEHIT |
| Purity/Format | Affinity purified |
| Blocking Peptide | TLR6 Blocking Peptide |
| Description | Rabbit polyclonal TLR6 antibody raised against the middle region of TLR6 |
| Gene | TLR6 |
| Supplier Page | Shop |