| Name | LAPTM4B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6318 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | LAPTM4B antibody was raised using the middle region of LAPTM4B corresponding to a region with amino acids YPNSIQEYIRQLPPNFPYRDDVMSVNPTCLVLIILLFISIILTFKGYLIS |
| Purity/Format | Affinity purified |
| Blocking Peptide | LAPTM4B Blocking Peptide |
| Description | Rabbit polyclonal LAPTM4B antibody raised against the middle region of LAPTM4B |
| Gene | LAPTM4B |
| Supplier Page | Shop |