| Name | NOVA1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4832 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | NOVA1 antibody was raised using the C terminal of NOVA1 corresponding to a region with amino acids SKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG |
| Purity/Format | Affinity purified |
| Blocking Peptide | NOVA1 Blocking Peptide |
| Description | Rabbit polyclonal NOVA1 antibody raised against the C terminal of NOVA1 |
| Gene | NOVA1 |
| Supplier Page | Shop |