| Name | ADAD2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4837 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ADAD2 antibody was raised using the middle region of ADAD2 corresponding to a region with amino acids GQQLHDCHGLVIARRALLRFLFRQLLLATQGGPKGKEQSVLAPQPGPGPP |
| Purity/Format | Affinity purified |
| Blocking Peptide | ADAD2 Blocking Peptide |
| Description | Rabbit polyclonal ADAD2 antibody raised against the middle region of ADAD2 |
| Gene | ADAD2 |
| Supplier Page | Shop |